Lineage for d5g31a_ (5g31 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2484065Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 2484376Protein automated matches [190442] (14 species)
    not a true protein
  7. 2484436Species Pacific white shrimp (Litopenaeus vannamei) [TaxId:6689] [197071] (10 PDB entries)
  8. 2484457Domain d5g31a_: 5g31 A: [330974]
    automated match to d4aj8a_
    complexed with zn; mutant

Details for d5g31a_

PDB Entry: 5g31 (more details), 2 Å

PDB Description: crystallographic structure of mutant c73s of thioredoxin from litopenaeus vannamei
PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d5g31a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5g31a_ c.47.1.1 (A:) automated matches {Pacific white shrimp (Litopenaeus vannamei) [TaxId: 6689]}
mvyqvkdqedftkqlneagnklvvidfyatwcgpckmiapkleelsqsmsdvvflkvdvd
ecediaqdnqiasmptflfmkngqkldslsganydkllelveknk

SCOPe Domain Coordinates for d5g31a_:

Click to download the PDB-style file with coordinates for d5g31a_.
(The format of our PDB-style files is described here.)

Timeline for d5g31a_: