SCOPe 2.08: Domain d5t4zl2: 5t4z L:108-211

Lineage for d5t4zl2 (5t4z L:108-211)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [226134] (27 PDB entries)

8. Domain d5t4zl2: 5t4z L:108-211 [330961]
   Other proteins in same PDB: d5t4za_, d5t4zb1, d5t4zh_, d5t4zl1
   automated match to d1aqkl2
   complexed with ca

Details for d5t4zl2

PDB Entry: 5t4z, 1.99 Å

PDB Description: structure of the anti-hiv antibody dh501 that binds gp120 v3 glycan and the base of v3 with free man9 glycan

PDB Compounds: (L:) antibody DH501 Fab light chain

SCOPe Domain Sequences for d5t4zl2:

Sequence; same for both SEQRES and ATOM records:

>d5t4zl2 b.1.1.2 (L:108-211) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
qpkasptvtlfppsseelqankatlvclisdfypgvvkvawkadgsavnagvetttpskq
snnkyaassylsltsdqwkshksyscqvthegstvektvapaec

Timeline for d5t4zl2:

• d5t4zl2 first appeared in SCOPe 2.06
  
• d5t4zl2 appears in SCOPe 2.07