SCOPe 2.07: Domain d1tkcb3: 1tkc B:535-680

Lineage for d1tkcb3 (1tkc B:535-680)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest

4. Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families)

5. Family c.48.1.1: Transketolase C-terminal domain-like [52923] (2 proteins)

6. Protein Transketolase (TK), C-domain [52924] (4 species)
   two N-terminal domains are PP and Pyr modules of thiamin-binding fold

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52925] (7 PDB entries)

8. Domain d1tkcb3: 1tkc B:535-680 [33095]
   Other proteins in same PDB: d1tkca1, d1tkca2, d1tkcb1, d1tkcb2
   complexed with ca, m6t

Details for d1tkcb3

PDB Entry: 1tkc, 2.7 Å

PDB Description: specificity of coenzyme binding in thiamin diphosphate dependent enzymes: crystal structures of yeast transketolase in complex with analogs of thiamin diphosphate

PDB Compounds: (B:) transketolase

SCOPe Domain Sequences for d1tkcb3:

Sequence; same for both SEQRES and ATOM records:

>d1tkcb3 c.48.1.1 (B:535-680) Transketolase (TK), C-domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
egssiesaskggyvlqdvanpdiilvatgsevslsveaaktlaaknikarvvslpdfftf
dkqpleyrlsvlpdnvpimsvevlattcwgkyahqsfgidrfgasgkapevfkffgftpe
gvaeraqktiafykgdklisplkkaf

Timeline for d1tkcb3:

• d1tkcb3 first appeared (with stable ids) in SCOP 1.55
  
• d1tkcb3 appears in SCOPe 2.06
  
• d1tkcb3 appears in the current release, SCOPe 2.08