Lineage for d1tkcb3 (1tkc B:535-680)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1855607Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 1855608Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) (S)
  5. 1855609Family c.48.1.1: Transketolase C-terminal domain-like [52923] (2 proteins)
  6. 1855628Protein Transketolase (TK), C-domain [52924] (4 species)
    two N-terminal domains are PP and Pyr modules of thiamin-binding fold
  7. 1855629Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52925] (7 PDB entries)
  8. 1855637Domain d1tkcb3: 1tkc B:535-680 [33095]
    Other proteins in same PDB: d1tkca1, d1tkca2, d1tkcb1, d1tkcb2
    complexed with ca, m6t

Details for d1tkcb3

PDB Entry: 1tkc (more details), 2.7 Å

PDB Description: specificity of coenzyme binding in thiamin diphosphate dependent enzymes: crystal structures of yeast transketolase in complex with analogs of thiamin diphosphate
PDB Compounds: (B:) transketolase

SCOPe Domain Sequences for d1tkcb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tkcb3 c.48.1.1 (B:535-680) Transketolase (TK), C-domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
egssiesaskggyvlqdvanpdiilvatgsevslsveaaktlaaknikarvvslpdfftf
dkqpleyrlsvlpdnvpimsvevlattcwgkyahqsfgidrfgasgkapevfkffgftpe
gvaeraqktiafykgdklisplkkaf

SCOPe Domain Coordinates for d1tkcb3:

Click to download the PDB-style file with coordinates for d1tkcb3.
(The format of our PDB-style files is described here.)

Timeline for d1tkcb3: