Lineage for d1tkcb3 (1tkc B:535-680)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 181442Fold c.48: Transketolase C-terminal domain-like [52921] (1 superfamily)
  4. 181443Superfamily c.48.1: Transketolase C-terminal domain-like [52922] (3 families) (S)
  5. 181444Family c.48.1.1: TK-like [52923] (2 proteins)
  6. 181449Protein Transketolase, TK [52924] (1 species)
  7. 181450Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52925] (7 PDB entries)
  8. 181462Domain d1tkcb3: 1tkc B:535-680 [33095]
    Other proteins in same PDB: d1tkca1, d1tkca2, d1tkcb1, d1tkcb2

Details for d1tkcb3

PDB Entry: 1tkc (more details), 2.7 Å

PDB Description: specificity of coenzyme binding in thiamin diphosphate dependent enzymes: crystal structures of yeast transketolase in complex with analogs of thiamin diphosphate

SCOP Domain Sequences for d1tkcb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tkcb3 c.48.1.1 (B:535-680) Transketolase, TK {Baker's yeast (Saccharomyces cerevisiae)}
egssiesaskggyvlqdvanpdiilvatgsevslsveaaktlaaknikarvvslpdfftf
dkqpleyrlsvlpdnvpimsvevlattcwgkyahqsfgidrfgasgkapevfkffgftpe
gvaeraqktiafykgdklisplkkaf

SCOP Domain Coordinates for d1tkcb3:

Click to download the PDB-style file with coordinates for d1tkcb3.
(The format of our PDB-style files is described here.)

Timeline for d1tkcb3: