Lineage for d5uuea_ (5uue A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2570195Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2570196Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2570210Family d.92.1.2: Thermolysin-like [55490] (5 proteins)
    includes alpha-helical C-terminal domain characteristic for the family
  6. 2570226Protein Thermolysin [63414] (3 species)
  7. 2570227Species Bacillus thermoproteolyticus [TaxId:1427] [55494] (191 PDB entries)
    Uniprot P00800
  8. 2570340Domain d5uuea_: 5uue A: [330931]
    automated match to d1kkka_
    complexed with ca, cl, moh, zn

Details for d5uuea_

PDB Entry: 5uue (more details), 1.6 Å

PDB Description: tetragonal thermolysin cryocooled to 100 k with 50% methanol as cryoprotectant
PDB Compounds: (A:) thermolysin

SCOPe Domain Sequences for d5uuea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uuea_ d.92.1.2 (A:) Thermolysin {Bacillus thermoproteolyticus [TaxId: 1427]}
itgtstvgvgrgvlgdqkninttystyyylqdntrgngiftydakyrttlpgslwadadn
qffasydapavdahyyagvtydyyknvhnrlsydgnnaairssvhysqgynnafwngsqm
vygdgdgqtfiplsggidvvahelthavtdytagliyqnesgaineaisdifgtlvefya
nknpdweigedvytpgisgdslrsmsdpakygdpdhyskrytgtqdnggvhinsgiinka
aylisqggthygvsvvgigrdklgkifyraltqyltptsnfsqlraaavqsatdlygsts
qevasvkqafdavgvk

SCOPe Domain Coordinates for d5uuea_:

Click to download the PDB-style file with coordinates for d5uuea_.
(The format of our PDB-style files is described here.)

Timeline for d5uuea_: