SCOP 1.61: Domain d1tkba3: 1tkb A:535-680

Lineage for d1tkba3 (1tkb A:535-680)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.48: Transketolase C-terminal domain-like [52921] (1 superfamily)

4. Superfamily c.48.1: Transketolase C-terminal domain-like [52922] (3 families)

5. Family c.48.1.1: TK-like [52923] (2 proteins)

6. Protein Transketolase, TK [52924] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52925] (7 PDB entries)

8. Domain d1tkba3: 1tkb A:535-680 [33092]
   Other proteins in same PDB: d1tkba1, d1tkba2, d1tkbb1, d1tkbb2

Details for d1tkba3

PDB Entry: 1tkb, 2.3 Å

PDB Description: specificity of coenzyme binding in thiamin diphosphate dependent enzymes: crystal structures of yeast transketolase in complex with analogs of thiamin diphosphate

SCOP Domain Sequences for d1tkba3:

Sequence; same for both SEQRES and ATOM records:

>d1tkba3 c.48.1.1 (A:535-680) Transketolase, TK {Baker's yeast (Saccharomyces cerevisiae)}
egssiesaskggyvlqdvanpdiilvatgsevslsveaaktlaaknikarvvslpdfftf
dkqpleyrlsvlpdnvpimsvevlattcwgkyahqsfgidrfgasgkapevfkffgftpe
gvaeraqktiafykgdklisplkkaf

Timeline for d1tkba3:

• d1tkba3 first appeared (with stable ids) in SCOP 1.55
  
• d1tkba3 appears in SCOP 1.59
  
• d1tkba3 appears in SCOP 1.63
  
• d1tkba3 appears in the current release, SCOPe 2.08