Lineage for d1tkba3 (1tkb A:535-680)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24575Fold c.48: Transketolase C-terminal domain-like [52921] (1 superfamily)
  4. 24576Superfamily c.48.1: Transketolase C-terminal domain-like [52922] (3 families) (S)
  5. 24577Family c.48.1.1: Transketolase [52923] (1 protein)
  6. 24578Protein Transketolase [52924] (1 species)
  7. 24579Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52925] (6 PDB entries)
  8. 24582Domain d1tkba3: 1tkb A:535-680 [33092]
    Other proteins in same PDB: d1tkba1, d1tkba2, d1tkbb1, d1tkbb2

Details for d1tkba3

PDB Entry: 1tkb (more details), 2.3 Å

PDB Description: specificity of coenzyme binding in thiamin diphosphate dependent enzymes: crystal structures of yeast transketolase in complex with analogs of thiamin diphosphate

SCOP Domain Sequences for d1tkba3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tkba3 c.48.1.1 (A:535-680) Transketolase {Baker's yeast (Saccharomyces cerevisiae)}
egssiesaskggyvlqdvanpdiilvatgsevslsveaaktlaaknikarvvslpdfftf
dkqpleyrlsvlpdnvpimsvevlattcwgkyahqsfgidrfgasgkapevfkffgftpe
gvaeraqktiafykgdklisplkkaf

SCOP Domain Coordinates for d1tkba3:

Click to download the PDB-style file with coordinates for d1tkba3.
(The format of our PDB-style files is described here.)

Timeline for d1tkba3: