Lineage for d1trkb3 (1trk B:535-680)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 123735Fold c.48: Transketolase C-terminal domain-like [52921] (1 superfamily)
  4. 123736Superfamily c.48.1: Transketolase C-terminal domain-like [52922] (3 families) (S)
  5. 123737Family c.48.1.1: Transketolase [52923] (1 protein)
  6. 123738Protein Transketolase [52924] (1 species)
  7. 123739Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52925] (7 PDB entries)
  8. 123743Domain d1trkb3: 1trk B:535-680 [33091]
    Other proteins in same PDB: d1trka1, d1trka2, d1trkb1, d1trkb2

Details for d1trkb3

PDB Entry: 1trk (more details), 2 Å

PDB Description: refined structure of transketolase from saccharomyces cerevisiae at 2.0 angstroms resolution

SCOP Domain Sequences for d1trkb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1trkb3 c.48.1.1 (B:535-680) Transketolase {Baker's yeast (Saccharomyces cerevisiae)}
egssiesaskggyvlqdvanpdiilvatgsevslsveaaktlaaknikarvvslpdfftf
dkqpleyrlsvlpdnvpimsvevlattcwgkyahqsfgidrfgasgkapevfkffgftpe
gvaeraqktiafykgdklisplkkaf

SCOP Domain Coordinates for d1trkb3:

Click to download the PDB-style file with coordinates for d1trkb3.
(The format of our PDB-style files is described here.)

Timeline for d1trkb3: