Lineage for d5t35a_ (5t35 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2706694Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2706927Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2706928Protein automated matches [190615] (15 species)
    not a true protein
  7. 2706959Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries)
  8. 2708267Domain d5t35a_: 5t35 A: [330904]
    Other proteins in same PDB: d5t35b_, d5t35c1, d5t35c2, d5t35d_, d5t35f_, d5t35g1, d5t35g2, d5t35h_
    automated match to d5c8ga_
    complexed with 759

Details for d5t35a_

PDB Entry: 5t35 (more details), 2.7 Å

PDB Description: the protac mz1 in complex with the second bromodomain of brd4 and pvhl:elonginc:elonginb
PDB Compounds: (A:) Bromodomain-containing protein 4

SCOPe Domain Sequences for d5t35a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t35a_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kvseqlkccsgilkemfakkhaayawpfykpvdvealglhdycdiikhpmdmstikskle
areyrdaqefgadvrlmfsncykynppdhevvamarklqdvfemrfakmpd

SCOPe Domain Coordinates for d5t35a_:

Click to download the PDB-style file with coordinates for d5t35a_.
(The format of our PDB-style files is described here.)

Timeline for d5t35a_: