Lineage for d5ux9c_ (5ux9 C:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2403213Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2403214Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2403509Family b.81.1.0: automated matches [191560] (1 protein)
    not a true family
  6. 2403510Protein automated matches [190967] (31 species)
    not a true protein
  7. 2403714Species Vibrio fischeri [TaxId:312309] [330859] (1 PDB entry)
  8. 2403717Domain d5ux9c_: 5ux9 C: [330899]
    automated match to d3eevb_
    complexed with act, cl, fmt, mes, mg

Details for d5ux9c_

PDB Entry: 5ux9 (more details), 2.7 Å

PDB Description: the crystal structure of chloramphenicol acetyltransferase from vibrio fischeri es114
PDB Compounds: (C:) Chloramphenicol acetyltransferase

SCOPe Domain Sequences for d5ux9c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ux9c_ b.81.1.0 (C:) automated matches {Vibrio fischeri [TaxId: 312309]}
afnswlegqnlkeqvknpnievgdysyysgfyhsktfeeqavryllgdaptqevwesgqf
gevdklrigkfcsiasgatfmmagnqghradwistfpfskkefgegvkdgfqragdtivg
ndvwigseamimpgvhigdgaiigaravitknvapysvvvgnnvvvkkrfdenliqtllv
ikwwdwplqhikntmeilcsghieeleqyfiknvg

SCOPe Domain Coordinates for d5ux9c_:

Click to download the PDB-style file with coordinates for d5ux9c_.
(The format of our PDB-style files is described here.)

Timeline for d5ux9c_: