Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) |
Family c.66.1.25: mRNA cap methylase [88785] (4 proteins) |
Protein automated matches [190302] (11 species) not a true protein |
Species Zika virus (strain mr 766) [TaxId:64320] [322798] (8 PDB entries) |
Domain d5wz2b_: 5wz2 B: [330896] automated match to d2px5a_ complexed with gta, sam |
PDB Entry: 5wz2 (more details), 2.6 Å
SCOPe Domain Sequences for d5wz2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5wz2b_ c.66.1.25 (B:) automated matches {Zika virus (strain mr 766) [TaxId: 64320]} etlgekwkarlnqmsalefysykksgitevcreearralkdgvatgghavsrgsaklrwl vergylqpygkvidlgcgrggwsyyaatirkvqevkgytkggpgheepvlvqsygwnivr lksgvdvfhmaaepcdtllcdigesssspeveeartlrvlsmvgdwlekrpgafcikvlc pytstmmetlerlqrryggglvrvplsrnsthemywvsgaksntiksvsttsqlllgrmd gprrpvkyeedvnlgsgtr
Timeline for d5wz2b_: