Lineage for d5t35d_ (5t35 D:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2378393Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2378586Superfamily b.3.3: VHL [49468] (1 family) (S)
    automatically mapped to Pfam PF01847
  5. 2378587Family b.3.3.1: VHL [49469] (2 proteins)
  6. 2378588Protein VHL [49470] (1 species)
  7. 2378589Species Human (Homo sapiens) [TaxId:9606] [49471] (39 PDB entries)
  8. 2378699Domain d5t35d_: 5t35 D: [330884]
    Other proteins in same PDB: d5t35a_, d5t35b_, d5t35c1, d5t35c2, d5t35e_, d5t35f_, d5t35g1, d5t35g2
    automated match to d1lqbc_
    complexed with 759

Details for d5t35d_

PDB Entry: 5t35 (more details), 2.7 Å

PDB Description: the protac mz1 in complex with the second bromodomain of brd4 and pvhl:elonginc:elonginb
PDB Compounds: (D:) von hippel-lindau disease tumor suppressor

SCOPe Domain Sequences for d5t35d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t35d_ b.3.3.1 (D:) VHL {Human (Homo sapiens) [TaxId: 9606]}
pvlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfr
dagthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldi
vrslyedledhpnvqkdlerltqeriahq

SCOPe Domain Coordinates for d5t35d_:

Click to download the PDB-style file with coordinates for d5t35d_.
(The format of our PDB-style files is described here.)

Timeline for d5t35d_: