![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.82.1: ALDH-like [53720] (3 families) ![]() binds NAD differently from other NAD(P)-dependent oxidoreductases |
![]() | Family c.82.1.1: ALDH-like [53721] (6 proteins) |
![]() | Protein automated matches [190401] (5 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189906] (28 PDB entries) |
![]() | Domain d5l2oh_: 5l2o H: [330862] automated match to d5ac2a_ complexed with 6zw, cl, yb |
PDB Entry: 5l2o (more details), 2.05 Å
SCOPe Domain Sequences for d5l2oh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l2oh_ c.82.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lpvlltdlkiqytkifinnewhdsvsgkkfpvfnpateeelcqveegdkedvdkavkaar qafqigspwrtmdasergrllykladlierdrlllatmesmnggklysnaylndlagcik tlrycagwadkiqgrtipidgnfftytrhepigvcgqiipwnfplvmliwkigpalscgn tvvvkpaeqtpltalhvaslikeagfppgvvnivpgygptagaaisshmdidkvaftgst evgklikeaagksnlkrvtlelggkspcivladadldnavefahhgvfyhqgqcciaasr ifveesiydefvrrsverakkyilgnpltpgvtqgpqidkeqydkildliesgkkegakl ecgggpwgnkgyfvqptvfsnvtdemriakeeifgpvqqimkfkslddvikranntfygl sagvftkdidkaitissalqagtvwvncygvvsaqcpfggfkmsgngrelgeygfheyte vktvtvkisqkns
Timeline for d5l2oh_: