SCOPe 2.06: Domain d5ux9b_: 5ux9 B:

Lineage for d5ux9b_ (5ux9 B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.0: automated matches [191560] (1 protein)
   not a true family

6. Protein automated matches [190967] (30 species)
   not a true protein

7. Species Vibrio fischeri [TaxId:312309] [330859] (1 PDB entry)

8. Domain d5ux9b_: 5ux9 B: [330860]
   automated match to d3eevb_
   complexed with act, cl, fmt, mes, mg

Details for d5ux9b_

PDB Entry: 5ux9, 2.7 Å

PDB Description: the crystal structure of chloramphenicol acetyltransferase from vibrio fischeri es114

PDB Compounds: (B:) Chloramphenicol acetyltransferase

SCOPe Domain Sequences for d5ux9b_:

Sequence; same for both SEQRES and ATOM records:

>d5ux9b_ b.81.1.0 (B:) automated matches {Vibrio fischeri [TaxId: 312309]}
afnswlegqnlkeqvknpnievgdysyysgfyhsktfeeqavryllgdaptqevwesgqf
gevdklrigkfcsiasgatfmmagnqghradwistfpfskkefgegvkdgfqragdtivg
ndvwigseamimpgvhigdgaiigaravitknvapysvvvgnnvvvkkrfdenliqtllv
ikwwdwplqhikntmeilcsghieeleqyfiknvg

Timeline for d5ux9b_:

• d5ux9b_ is new in SCOPe 2.06-stable
  
• d5ux9b_ appears in SCOPe 2.07
  
• d5ux9b_ appears in the current release, SCOPe 2.08