SCOPe 2.08: Domain d5jp7a1: 5jp7 A:2-126

Lineage for d5jp7a1 (5jp7 A:2-126)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.3: Cytochromes [47175] (3 families)
   Heme-containing proteins

5. Family a.24.3.2: Cytochrome c'-like [47179] (3 proteins)
   automatically mapped to Pfam PF01322

6. Protein automated matches [190363] (5 species)
   not a true protein

7. Species Alcaligenes xylosoxydans [TaxId:85698] [330675] (8 PDB entries)

8. Domain d5jp7a1: 5jp7 A:2-126 [330854]
   Other proteins in same PDB: d5jp7a2
   automated match to d4cdaa_
   complexed with hec; mutant

Details for d5jp7a1

PDB Entry: 5jp7, 1.26 Å

PDB Description: ferrous leu 16 val mutant of cytochrome c prime from alcaligenes xylosoxidans

PDB Compounds: (A:) cytochrome c'

SCOPe Domain Sequences for d5jp7a1:

Sequence; same for both SEQRES and ATOM records:

>d5jp7a1 a.24.3.2 (A:2-126) automated matches {Alcaligenes xylosoxydans [TaxId: 85698]}
fakpedavkyrqsavtlmashfgrmtpvvkgqapydaaqikanvevlktlsalpwaafgp
gteggdarpeiwsdaasfkqkqqafqdnivklsaaadagdldklraafgdvgasckachd
ayrkk

Timeline for d5jp7a1:

• d5jp7a1 first appeared in SCOPe 2.06
  
• d5jp7a1 appears in SCOPe 2.07