Lineage for d1qmib1 (1qmi B:185-279)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 833461Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 834836Superfamily c.47.2: RNA 3'-terminal phosphate cyclase, RPTC, insert domain [52913] (1 family) (S)
  5. 834837Family c.47.2.1: RNA 3'-terminal phosphate cyclase, RPTC, insert domain [52914] (1 protein)
  6. 834838Protein RNA 3'-terminal phosphate cyclase, RPTC, insert domain [52915] (1 species)
  7. 834839Species Escherichia coli [TaxId:562] [52916] (2 PDB entries)
  8. 834843Domain d1qmib1: 1qmi B:185-279 [33085]
    Other proteins in same PDB: d1qmia2, d1qmib2, d1qmic2, d1qmid2

Details for d1qmib1

PDB Entry: 1qmi (more details), 2.8 Å

PDB Description: Crystal structure of RNA 3'-terminal phosphate cyclase, an ubiquitous enzyme with unusual topology
PDB Compounds: (B:) RNA 3'-terminal phosphate cyclase

SCOP Domain Sequences for d1qmib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qmib1 c.47.2.1 (B:185-279) RNA 3'-terminal phosphate cyclase, RPTC, insert domain {Escherichia coli [TaxId: 562]}
ergnivqmrgevllagvprhvaereiatlagsfslheqnihnlprdqgpgntvslevese
niterffvvgekrvsaevvaaqlvkevkrylasta

SCOP Domain Coordinates for d1qmib1:

Click to download the PDB-style file with coordinates for d1qmib1.
(The format of our PDB-style files is described here.)

Timeline for d1qmib1: