Lineage for d5t35f_ (5t35 F:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2931223Protein Elongin B [54246] (2 species)
  7. 2931224Species Human (Homo sapiens) [TaxId:9606] [54247] (53 PDB entries)
  8. 2931356Domain d5t35f_: 5t35 F: [330849]
    Other proteins in same PDB: d5t35a_, d5t35c1, d5t35c2, d5t35d_, d5t35e_, d5t35g1, d5t35g2, d5t35h_
    automated match to d1lqba_
    complexed with 759

Details for d5t35f_

PDB Entry: 5t35 (more details), 2.7 Å

PDB Description: the protac mz1 in complex with the second bromodomain of brd4 and pvhl:elonginc:elonginb
PDB Compounds: (F:) Transcription elongation factor B polypeptide 2

SCOPe Domain Sequences for d5t35f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t35f_ d.15.1.1 (F:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppelpdvmk

SCOPe Domain Coordinates for d5t35f_:

Click to download the PDB-style file with coordinates for d5t35f_.
(The format of our PDB-style files is described here.)

Timeline for d5t35f_: