Lineage for d5t35c1 (5t35 C:17-112)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2189359Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2189360Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2189361Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)
  6. 2189438Protein Elongin C [54699] (3 species)
  7. 2189441Species Human (Homo sapiens) [TaxId:9606] [54700] (41 PDB entries)
  8. 2189562Domain d5t35c1: 5t35 C:17-112 [330841]
    Other proteins in same PDB: d5t35a_, d5t35b_, d5t35c2, d5t35d_, d5t35e_, d5t35f_, d5t35g2, d5t35h_
    automated match to d1lm8c_
    complexed with 759

Details for d5t35c1

PDB Entry: 5t35 (more details), 2.7 Å

PDB Description: the protac mz1 in complex with the second bromodomain of brd4 and pvhl:elonginc:elonginb
PDB Compounds: (C:) Transcription elongation factor B polypeptide 1

SCOPe Domain Sequences for d5t35c1:

Sequence, based on SEQRES records: (download)

>d5t35c1 d.42.1.1 (C:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
ftykvrytnssteipefpiapeialellmaanfldc

Sequence, based on observed residues (ATOM records): (download)

>d5t35c1 d.42.1.1 (C:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsnevnfreipshvlskvcmyftykvrytns
steipefpiapeialellmaanfldc

SCOPe Domain Coordinates for d5t35c1:

Click to download the PDB-style file with coordinates for d5t35c1.
(The format of our PDB-style files is described here.)

Timeline for d5t35c1: