![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
![]() | Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
![]() | Protein automated matches [190039] (161 species) not a true protein |
![]() | Species Brucella abortus [TaxId:359391] [328149] (2 PDB entries) |
![]() | Domain d5uvee1: 5uve E:26-304 [330835] Other proteins in same PDB: d5uvea2, d5uveb2, d5uvec2, d5uved2, d5uvee2, d5uvef2, d5uveg2, d5uveh2 automated match to d4ne4a_ complexed with ca, gol |
PDB Entry: 5uve (more details), 2.5 Å
SCOPe Domain Sequences for d5uvee1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5uvee1 c.94.1.0 (E:26-304) automated matches {Brucella abortus [TaxId: 359391]} vavsskidteggvlgniiltvlnangikttdriqlgatpvvrkaitageidiypeytgna afffnkaddplwkdpakayetakkldydankivwltpspanntwgiavrkdvanenklas lsdfgkyiagggkvvlaassefvnsaaalpafqtaygftlkpdqlitlsggdtaatiaaa anqtnganaamvygtdggiapsglvvleddkhvqpvyqpapiireevlkkdpkieellkp vfekldlttlqdlngrvqlggepakavaedflkkngflk
Timeline for d5uvee1: