Lineage for d1qmhb1 (1qmh B:185-279)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2135221Superfamily c.47.2: RNA 3'-terminal phosphate cyclase, RPTC, insert domain [52913] (1 family) (S)
    automatically mapped to Pfam PF05189
  5. 2135222Family c.47.2.1: RNA 3'-terminal phosphate cyclase, RPTC, insert domain [52914] (1 protein)
  6. 2135223Protein RNA 3'-terminal phosphate cyclase, RPTC, insert domain [52915] (1 species)
  7. 2135224Species Escherichia coli [TaxId:562] [52916] (2 PDB entries)
  8. 2135226Domain d1qmhb1: 1qmh B:185-279 [33083]
    Other proteins in same PDB: d1qmha2, d1qmhb2
    CASP3
    complexed with cit, dto

Details for d1qmhb1

PDB Entry: 1qmh (more details), 2.1 Å

PDB Description: Crystal structure of RNA 3'-terminal phosphate cyclase, an ubiquitous enzyme with unusual topology
PDB Compounds: (B:) RNA 3'-terminal phosphate cyclase

SCOPe Domain Sequences for d1qmhb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qmhb1 c.47.2.1 (B:185-279) RNA 3'-terminal phosphate cyclase, RPTC, insert domain {Escherichia coli [TaxId: 562]}
ergnivqmrgevllagvprhvaereiatlagsfslheqnihnlprdqgpgntvslevese
niterffvvgekrvsaevvaaqlvkevkrylasta

SCOPe Domain Coordinates for d1qmhb1:

Click to download the PDB-style file with coordinates for d1qmhb1.
(The format of our PDB-style files is described here.)

Timeline for d1qmhb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qmhb2