Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.2: RNA 3'-terminal phosphate cyclase, RPTC, insert domain [52913] (1 family) automatically mapped to Pfam PF05189 |
Family c.47.2.1: RNA 3'-terminal phosphate cyclase, RPTC, insert domain [52914] (1 protein) |
Protein RNA 3'-terminal phosphate cyclase, RPTC, insert domain [52915] (1 species) |
Species Escherichia coli [TaxId:562] [52916] (2 PDB entries) |
Domain d1qmhb1: 1qmh B:185-279 [33083] Other proteins in same PDB: d1qmha2, d1qmhb2 CASP3 complexed with cit, dto |
PDB Entry: 1qmh (more details), 2.1 Å
SCOPe Domain Sequences for d1qmhb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qmhb1 c.47.2.1 (B:185-279) RNA 3'-terminal phosphate cyclase, RPTC, insert domain {Escherichia coli [TaxId: 562]} ergnivqmrgevllagvprhvaereiatlagsfslheqnihnlprdqgpgntvslevese niterffvvgekrvsaevvaaqlvkevkrylasta
Timeline for d1qmhb1: