SCOPe 2.05: Domain d1qmhb1: 1qmh B:185-279

Lineage for d1qmhb1 (1qmh B:185-279)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.2: RNA 3'-terminal phosphate cyclase, RPTC, insert domain [52913] (1 family)
   automatically mapped to Pfam PF05189

5. Family c.47.2.1: RNA 3'-terminal phosphate cyclase, RPTC, insert domain [52914] (1 protein)

6. Protein RNA 3'-terminal phosphate cyclase, RPTC, insert domain [52915] (1 species)

7. Species Escherichia coli [TaxId:562] [52916] (2 PDB entries)

8. Domain d1qmhb1: 1qmh B:185-279 [33083]
   Other proteins in same PDB: d1qmha2, d1qmhb2
   CASP3
   complexed with cit, dto

Details for d1qmhb1

PDB Entry: 1qmh, 2.1 Å

PDB Description: Crystal structure of RNA 3'-terminal phosphate cyclase, an ubiquitous enzyme with unusual topology

PDB Compounds: (B:) RNA 3'-terminal phosphate cyclase

SCOPe Domain Sequences for d1qmhb1:

Sequence; same for both SEQRES and ATOM records:

>d1qmhb1 c.47.2.1 (B:185-279) RNA 3'-terminal phosphate cyclase, RPTC, insert domain {Escherichia coli [TaxId: 562]}
ergnivqmrgevllagvprhvaereiatlagsfslheqnihnlprdqgpgntvslevese
niterffvvgekrvsaevvaaqlvkevkrylasta

Timeline for d1qmhb1:

• d1qmhb1 first appeared (with stable ids) in SCOP 1.55
  
• d1qmhb1 appears in SCOPe 2.04
  
• d1qmhb1 appears in SCOPe 2.06
  
• d1qmhb1 appears in the current release, SCOPe 2.08