Lineage for d1qmha1 (1qmh A:185-279)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24115Fold c.47: Thioredoxin fold [52832] (3 superfamilies)
  4. 24559Superfamily c.47.2: RNA 3'-terminal phosphate cyclase, RPTC, insert domain [52913] (1 family) (S)
  5. 24560Family c.47.2.1: RNA 3'-terminal phosphate cyclase, RPTC, insert domain [52914] (1 protein)
  6. 24561Protein RNA 3'-terminal phosphate cyclase, RPTC, insert domain [52915] (1 species)
  7. 24562Species Escherichia coli [TaxId:562] [52916] (2 PDB entries)
  8. 24563Domain d1qmha1: 1qmh A:185-279 [33082]
    Other proteins in same PDB: d1qmha2, d1qmhb2

Details for d1qmha1

PDB Entry: 1qmh (more details), 2.1 Å

PDB Description: Crystal structure of RNA 3'-terminal phosphate cyclase, an ubiquitous enzyme with unusual topology

SCOP Domain Sequences for d1qmha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qmha1 c.47.2.1 (A:185-279) RNA 3'-terminal phosphate cyclase, RPTC, insert domain {Escherichia coli}
ergnivqmrgevllagvprhvaereiatlagsfslheqnihnlprdqgpgntvslevese
niterffvvgekrvsaevvaaqlvkevkrylasta

SCOP Domain Coordinates for d1qmha1:

Click to download the PDB-style file with coordinates for d1qmha1.
(The format of our PDB-style files is described here.)

Timeline for d1qmha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qmha2