![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
![]() | Protein Phenol hydroxylase, C-terminal domain [52911] (1 species) |
![]() | Species Soil-living yeast (Trichosporon cutaneum) [TaxId:5554] [52912] (2 PDB entries) |
![]() | Domain d1fohd3: 1foh D:462-662 [33081] Other proteins in same PDB: d1foha4, d1foha5, d1fohb4, d1fohb5, d1fohc4, d1fohc5, d1fohd4, d1fohd5 complexed with fad, iph |
PDB Entry: 1foh (more details), 2.4 Å
SCOPe Domain Sequences for d1fohd3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fohd3 c.47.1.10 (D:462-662) Phenol hydroxylase, C-terminal domain {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} nlvtdkksskqelakncvvgtrfksqpvvrhseglwmhfgdrlvtdgrfriivfagkatd atqmsrikkfsayldsensvislytpkvsdrnsridvitihschrddiemhdfpapalhp kwqydfiyadcdswhhphpksyqawgvdetkgavvvvrpdgytslvtdlegtaeidryfs gilvepkeksgaqteadwtks
Timeline for d1fohd3: