Lineage for d5svua_ (5svu A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970344Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2970628Family d.110.3.0: automated matches [191387] (1 protein)
    not a true family
  6. 2970629Protein automated matches [190492] (24 species)
    not a true protein
  7. 2970816Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188508] (7 PDB entries)
  8. 2970845Domain d5svua_: 5svu A: [330804]
    automated match to d4r38b_
    complexed with fmn

Details for d5svua_

PDB Entry: 5svu (more details), 2.6 Å

PDB Description: structure and kinetics of the lov domain of zeitlupe determine its circadian function in arabidopsis
PDB Compounds: (A:) Adagio protein 1

SCOPe Domain Sequences for d5svua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5svua_ d.110.3.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
htapcgfvvtdavepdqpiiyvntvfemvtgyraeevlgrncrflqcrgpfakrrhplvd
smvvseirkcidegiefqgellnfrkdgsplmnrlrltpiygdddtithiigiqffietd
i

SCOPe Domain Coordinates for d5svua_:

Click to download the PDB-style file with coordinates for d5svua_.
(The format of our PDB-style files is described here.)

Timeline for d5svua_: