Lineage for d5u4ka_ (5u4k A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311002Fold a.12: Kix domain of CBP (creb binding protein) [47039] (1 superfamily)
    3 helices; bundle, partly opened
  4. 2311003Superfamily a.12.1: Kix domain of CBP (creb binding protein) [47040] (1 family) (S)
    automatically mapped to Pfam PF02172
  5. 2311004Family a.12.1.1: Kix domain of CBP (creb binding protein) [47041] (1 protein)
  6. 2311005Protein Kix domain of CBP (creb binding protein) [47042] (1 species)
  7. 2311006Species Mouse (Mus musculus) [TaxId:10090] [47043] (13 PDB entries)
  8. 2311015Domain d5u4ka_: 5u4k A: [330802]
    automated match to d2lxsa_

Details for d5u4ka_

PDB Entry: 5u4k (more details)

PDB Description: nmr structure of the complex between the kix domain of cbp and the transactivation domain 1 of p65
PDB Compounds: (A:) creb-binding protein

SCOPe Domain Sequences for d5u4ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u4ka_ a.12.1.1 (A:) Kix domain of CBP (creb binding protein) {Mouse (Mus musculus) [TaxId: 10090]}
gvrkgwhehvtqdlrshlvhklvqaifptpdpaalkdrrmenlvayakkvegdmyesans
rdeyyhllaekiykiqkeleekrrsrl

SCOPe Domain Coordinates for d5u4ka_:

Click to download the PDB-style file with coordinates for d5u4ka_.
(The format of our PDB-style files is described here.)

Timeline for d5u4ka_: