![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins) oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus binds a bilin chromophore automatically mapped to Pfam PF00502 |
![]() | Protein automated matches [190531] (23 species) not a true protein |
![]() | Species Pseudanabaena sp. [TaxId:1357935] [330784] (1 PDB entry) |
![]() | Domain d5toue_: 5tou E: [330799] automated match to d1cpca_ complexed with cyc |
PDB Entry: 5tou (more details), 2.04 Å
SCOPe Domain Sequences for d5toue_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5toue_ a.1.1.3 (E:) automated matches {Pseudanabaena sp. [TaxId: 1357935]} mktplteavsaadsqgrflsttetqvafgrfrqatsglaaakalsekaeslasgaanavy skfpyttsmtganyassqtgkdkcvrdigyyirmvtyccvvggtgpmddylvagiaeinr tfdlspswyvealkyvkanhglsgdsaveansyidyainals
Timeline for d5toue_: