Lineage for d5toua_ (5tou A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2302308Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 2302507Protein automated matches [190531] (20 species)
    not a true protein
  7. 2302724Species Pseudanabaena sp. [TaxId:1357935] [330784] (1 PDB entry)
  8. 2302725Domain d5toua_: 5tou A: [330797]
    automated match to d1cpca_
    complexed with cyc

Details for d5toua_

PDB Entry: 5tou (more details), 2.04 Å

PDB Description: structure of c-phycocyanin from arctic pseudanabaena sp. lw0831
PDB Compounds: (A:) Phycocyanin alpha-1 subunit

SCOPe Domain Sequences for d5toua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5toua_ a.1.1.3 (A:) automated matches {Pseudanabaena sp. [TaxId: 1357935]}
mktplteavsaadsqgrflsttetqvafgrfrqatsglaaakalsekaeslasgaanavy
skfpyttsmtganyassqtgkdkcvrdigyyirmvtyccvvggtgpmddylvagiaeinr
tfdlspswyvealkyvkanhglsgdsaveansyidyainals

SCOPe Domain Coordinates for d5toua_:

Click to download the PDB-style file with coordinates for d5toua_.
(The format of our PDB-style files is described here.)

Timeline for d5toua_: