Class a: All alpha proteins [46456] (289 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins) oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus binds a bilin chromophore automatically mapped to Pfam PF00502 |
Protein automated matches [190531] (18 species) not a true protein |
Species Pseudanabaena sp. [TaxId:1357935] [330784] (1 PDB entry) |
Domain d5toua_: 5tou A: [330797] automated match to d1cpca_ complexed with cyc |
PDB Entry: 5tou (more details), 2.04 Å
SCOPe Domain Sequences for d5toua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5toua_ a.1.1.3 (A:) automated matches {Pseudanabaena sp. [TaxId: 1357935]} mktplteavsaadsqgrflsttetqvafgrfrqatsglaaakalsekaeslasgaanavy skfpyttsmtganyassqtgkdkcvrdigyyirmvtyccvvggtgpmddylvagiaeinr tfdlspswyvealkyvkanhglsgdsaveansyidyainals
Timeline for d5toua_: