SCOPe 2.07: Domain d5im1a1: 5im1 A:13-220

Lineage for d5im1a1 (5im1 A:13-220)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families)

5. Family a.102.4.0: automated matches [227201] (1 protein)
   not a true family

6. Protein automated matches [226931] (11 species)
   not a true protein

7. Species Tobacco (Nicotiana tabacum) [TaxId:4097] [225865] (22 PDB entries)

8. Domain d5im1a1: 5im1 A:13-220 [330794]
   Other proteins in same PDB: d5im1a2
   automated match to d3lz9a1

Details for d5im1a1

PDB Entry: 5im1, 1.88 Å

PDB Description: tobacco 5-epi-aristolochene synthase without buffer molecule in the active site

PDB Compounds: (A:) 5-epi-aristolochene synthase

SCOPe Domain Sequences for d5im1a1:

Sequence; same for both SEQRES and ATOM records:

>d5im1a1 a.102.4.0 (A:13-220) automated matches {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
ivrpvadfspslwgdqflsfsiknqvaekyakeiealkeqtrnmllatgmkladtlnlid
tierlgisyhfekeiddildqiynqnsncndlctsalqfrllrqhgfnispeifskfqde
ngkfkeslasdvlgllnlyeashvrthaddiledalafstihlesaaphlksplreqvth
aleqclhkgvprvetrffissiydkeqs

Timeline for d5im1a1:

• d5im1a1 first appeared in SCOPe 2.06
  
• d5im1a1 appears in the current release, SCOPe 2.08