![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
![]() | Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) ![]() |
![]() | Family a.102.4.0: automated matches [227201] (1 protein) not a true family |
![]() | Protein automated matches [226931] (12 species) not a true protein |
![]() | Species Tobacco (Nicotiana tabacum) [TaxId:4097] [225865] (22 PDB entries) |
![]() | Domain d5im1a1: 5im1 A:13-220 [330794] Other proteins in same PDB: d5im1a2 automated match to d3lz9a1 |
PDB Entry: 5im1 (more details), 1.88 Å
SCOPe Domain Sequences for d5im1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5im1a1 a.102.4.0 (A:13-220) automated matches {Tobacco (Nicotiana tabacum) [TaxId: 4097]} ivrpvadfspslwgdqflsfsiknqvaekyakeiealkeqtrnmllatgmkladtlnlid tierlgisyhfekeiddildqiynqnsncndlctsalqfrllrqhgfnispeifskfqde ngkfkeslasdvlgllnlyeashvrthaddiledalafstihlesaaphlksplreqvth aleqclhkgvprvetrffissiydkeqs
Timeline for d5im1a1: