Lineage for d1fohb3 (1foh B:462-664)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24115Fold c.47: Thioredoxin fold [52832] (3 superfamilies)
  4. 24116Superfamily c.47.1: Thioredoxin-like [52833] (10 families) (S)
  5. 24524Family c.47.1.10: Glutathione peroxidase-like [52901] (5 proteins)
  6. 24533Protein Phenol hydroxylase, C-terminal domain [52911] (1 species)
  7. 24534Species Soil-living yeast (Trichosporon cutaneum) [TaxId:5554] [52912] (1 PDB entry)
  8. 24536Domain d1fohb3: 1foh B:462-664 [33079]
    Other proteins in same PDB: d1foha4, d1foha5, d1fohb4, d1fohb5, d1fohc4, d1fohc5, d1fohd4, d1fohd5

Details for d1fohb3

PDB Entry: 1foh (more details), 2.4 Å

PDB Description: phenol hydroxylase from trichosporon cutaneum

SCOP Domain Sequences for d1fohb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fohb3 c.47.1.10 (B:462-664) Phenol hydroxylase, C-terminal domain {Soil-living yeast (Trichosporon cutaneum)}
nlvtdkksskqelakncvvgtrfksqpvvrhseglwmhfgdrlvtdgrfriivfagkatd
atqmsrikkfsayldsensvislytpkvsdrnsridvitihschrddiemhdfpapalhp
kwqydfiyadcdswhhphpksyqawgvdetkgavvvvrpdgytslvtdlegtaeidryfs
gilvepkeksgaqteadwtksta

SCOP Domain Coordinates for d1fohb3:

Click to download the PDB-style file with coordinates for d1fohb3.
(The format of our PDB-style files is described here.)

Timeline for d1fohb3: