![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
![]() | Superfamily d.42.1: POZ domain [54695] (3 families) ![]() |
![]() | Family d.42.1.1: BTB/POZ domain [54696] (6 proteins) |
![]() | Protein Elongin C [54699] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54700] (41 PDB entries) |
![]() | Domain d5t35g1: 5t35 G:17-112 [330789] Other proteins in same PDB: d5t35a_, d5t35b_, d5t35c2, d5t35d_, d5t35e_, d5t35f_, d5t35g2, d5t35h_ automated match to d1lm8c_ complexed with 759 |
PDB Entry: 5t35 (more details), 2.7 Å
SCOPe Domain Sequences for d5t35g1:
Sequence, based on SEQRES records: (download)
>d5t35g1 d.42.1.1 (G:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]} myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy ftykvrytnssteipefpiapeialellmaanfldc
>d5t35g1 d.42.1.1 (G:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]} myvklissdghefivkrehaltsgtikamlsgnevnfreipshvlskvcmyftykvrytn ssteipefpiapeialellmaanfldc
Timeline for d5t35g1: