SCOPe 2.08: Domain d5t35g1: 5t35 G:17-112

Lineage for d5t35g1 (5t35 G:17-112)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)

6. Protein Elongin C [54699] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54700] (56 PDB entries)

8. Domain d5t35g1: 5t35 G:17-112 [330789]
   Other proteins in same PDB: d5t35a_, d5t35b_, d5t35c2, d5t35d_, d5t35e_, d5t35f_, d5t35g2, d5t35h_
   automated match to d1lm8c_
   complexed with 759

Details for d5t35g1

PDB Entry: 5t35, 2.7 Å

PDB Description: the protac mz1 in complex with the second bromodomain of brd4 and pvhl:elonginc:elonginb

PDB Compounds: (G:) Transcription elongation factor B polypeptide 1

SCOPe Domain Sequences for d5t35g1:

Sequence, based on SEQRES records:

>d5t35g1 d.42.1.1 (G:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
ftykvrytnssteipefpiapeialellmaanfldc

Sequence, based on observed residues (ATOM records):

>d5t35g1 d.42.1.1 (G:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgnevnfreipshvlskvcmyftykvrytn
ssteipefpiapeialellmaanfldc

Timeline for d5t35g1:

• d5t35g1 first appeared in SCOPe 2.06
  
• d5t35g1 appears in SCOPe 2.07