Class b: All beta proteins [48724] (180 folds) |
Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) |
Family b.84.2.0: automated matches [254217] (1 protein) not a true family |
Protein automated matches [254496] (16 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [330750] (1 PDB entry) |
Domain d5mlkb2: 5mlk B:340-465 [330771] Other proteins in same PDB: d5mlka1, d5mlka2, d5mlkb1, d5mlkb3 automated match to d2c00a3 |
PDB Entry: 5mlk (more details), 1.94 Å
SCOPe Domain Sequences for d5mlkb2:
Sequence, based on SEQRES records: (download)
>d5mlkb2 b.84.2.0 (B:340-465) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} rghaiefringedagrnflpapgpvtkfhppsgpgvrvdsgvetgsviggqfdsmlakli vhgadraealararralnefgveglatvipfhravvsdpafigdangfsvhtrwietewn ntiepf
>d5mlkb2 b.84.2.0 (B:340-465) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} rghaiefringedagrnflpapgpvtkfhppsgpgvrvdsgvetgsviggqfdsmlakli vhgadraealararralnefgveglatvipfhravvsdpafiggfsvhtrwietewnnti epf
Timeline for d5mlkb2: