Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
Family c.30.1.0: automated matches [227183] (1 protein) not a true family |
Protein automated matches [226903] (39 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [330746] (1 PDB entry) |
Domain d5mlkb1: 5mlk B:10-124 [330770] Other proteins in same PDB: d5mlka2, d5mlka3, d5mlkb2, d5mlkb3 automated match to d2vqda1 |
PDB Entry: 5mlk (more details), 1.94 Å
SCOPe Domain Sequences for d5mlkb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mlkb1 c.30.1.0 (B:10-124) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} ariskvlvanrgeiavrviraardaglpsvavyaepdaesphvrladeafalggqtsaes yldfakildaaaksganaihpgygflaenadfaqavidagliwigpspqsirdlg
Timeline for d5mlkb1: