Lineage for d5mlkb1 (5mlk B:10-124)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470135Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2470136Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2470597Family c.30.1.0: automated matches [227183] (1 protein)
    not a true family
  6. 2470598Protein automated matches [226903] (39 species)
    not a true protein
  7. 2470706Species Mycobacterium tuberculosis [TaxId:83332] [330746] (1 PDB entry)
  8. 2470708Domain d5mlkb1: 5mlk B:10-124 [330770]
    Other proteins in same PDB: d5mlka2, d5mlka3, d5mlkb2, d5mlkb3
    automated match to d2vqda1

Details for d5mlkb1

PDB Entry: 5mlk (more details), 1.94 Å

PDB Description: biotin dependent carboxylase acca3 dimer from mycobacterium tuberculosis (rv3285)
PDB Compounds: (B:) acetyl-coa carboxylase

SCOPe Domain Sequences for d5mlkb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mlkb1 c.30.1.0 (B:10-124) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
ariskvlvanrgeiavrviraardaglpsvavyaepdaesphvrladeafalggqtsaes
yldfakildaaaksganaihpgygflaenadfaqavidagliwigpspqsirdlg

SCOPe Domain Coordinates for d5mlkb1:

Click to download the PDB-style file with coordinates for d5mlkb1.
(The format of our PDB-style files is described here.)

Timeline for d5mlkb1: