Lineage for d1prxb_ (1prx B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116932Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2116933Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2118053Family c.47.1.10: Glutathione peroxidase-like [52901] (29 protein domains)
  6. 2118054Protein 1-Cys peroxiredoxin [52909] (3 species)
  7. 2118055Species Human (Homo sapiens) [TaxId:9606] [52910] (3 PDB entries)
  8. 2118057Domain d1prxb_: 1prx B: [33077]

Details for d1prxb_

PDB Entry: 1prx (more details), 2 Å

PDB Description: horf6 a novel human peroxidase enzyme
PDB Compounds: (B:) horf6

SCOPe Domain Sequences for d1prxb_:

Sequence, based on SEQRES records: (download)

>d1prxb_ c.47.1.10 (B:) 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: 9606]}
pgglllgdvapnfeanttvgrirfhdflgdswgilfshprdftpvcttelgraaklapef
akrnvklialsidsvedhlawskdinaynseepteklpfpiiddrnrelaillgmldpae
kdekgmpvtarvvfvfgpdkklklsilypattgrnfdeilrvvislqltaekrvatpvdw
kdgdsvmvlptipeeeakklfpkgvftkelpsgkkylrytpqp

Sequence, based on observed residues (ATOM records): (download)

>d1prxb_ c.47.1.10 (B:) 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: 9606]}
pgglllgdvapnfeanttvgrirfhdflgdswgilfshprdftpvcttelgraaklapef
akrnvklialsidsvedhlawskdinaynseepteklpfpiiddrnrelaillgmldpae
mpvtarvvfvfgpdkklklsilypattgrnfdeilrvvislqltaekrvatpvdwkdgds
vmvlptipeeeakklfpkgvftkelpsgkkylrytpqp

SCOPe Domain Coordinates for d1prxb_:

Click to download the PDB-style file with coordinates for d1prxb_.
(The format of our PDB-style files is described here.)

Timeline for d1prxb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1prxa_