Lineage for d1prxa_ (1prx A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.47: Thioredoxin fold [52832] (3 superfamilies) Superfamily c.47.1: Thioredoxin-like [52833] (10 families) 
Family c.47.1.10: Glutathione peroxidase-like [52901] (5 proteins) 
Protein HorF6 peroxidase [52909] (1 species) Species Human (Homo sapiens) [TaxId:9606] [52910] (1 PDB entry) 
Domain d1prxa_: 1prx A: [33076]
Details for d1prxa_
PDB Entry: 1prx (more details), 2 Å
PDB Description: horf6 a novel human peroxidase enzyme
SCOP Domain Sequences for d1prxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1prxa_ c.47.1.10 (A:) HorF6 peroxidase {Human (Homo sapiens)}
lllgdvapnfeanttvgrirfhdflgdswgilfshprdftpvcttelgraaklapefakr
nvklialsidsvedhlawskdinaynseepteklpfpiiddrnrelaillgmldpaekde
kgmpvtarvvfvfgpdkklklsilypattgrnfdeilrvvislqltaekrvatpvdwkdg
dsvmvlptipeeeakklfpkgvftkelpsgkkylrytpqp
SCOP Domain Coordinates for d1prxa_:
Click to download the PDB-style file with coordinates for d1prxa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1prxa_:
- d1prxa_ appears in SCOP 1.57
- d1prxa_ appears in the current release, SCOPe 2.08
View in 3D
