SCOPe 2.08: Domain d5ijma1: 5ijm A:1-96

Lineage for d5ijma1 (5ijm A:1-96)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
   core: 3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.11.1: Acyl-CoA binding protein [47027] (2 families)

5. Family a.11.1.0: automated matches [191596] (1 protein)
   not a true family

6. Protein automated matches [191086] (6 species)
   not a true protein

7. Species Leishmania major [TaxId:5664] [330757] (1 PDB entry)

8. Domain d5ijma1: 5ijm A:1-96 [330758]
   Other proteins in same PDB: d5ijma2
   automated match to d2cb8a_

Details for d5ijma1

PDB Entry: 5ijm, 1.46 Å

PDB Description: crystal structure of an acyl-coa binding protein (lmjf.17.0620) of leishmania major

PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d5ijma1:

Sequence; same for both SEQRES and ATOM records:

>d5ijma1 a.11.1.0 (A:1-96) automated matches {Leishmania major [TaxId: 5664]}
msaadfeaavayvrslpkegpvqldnaaklqfyslykqategdvtgsqpwavqvearakw
dawnsckgmksedakaayvrrlltllrsqgiqwkpg

Timeline for d5ijma1:

• d5ijma1 first appeared in SCOPe 2.06
  
• d5ijma1 appears in SCOPe 2.07