Lineage for d5h20a_ (5h20 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307971Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2307972Protein automated matches [190154] (87 species)
    not a true protein
  7. 2308028Species Bacteroides fragilis [TaxId:272559] [330755] (1 PDB entry)
  8. 2308029Domain d5h20a_: 5h20 A: [330756]
    automated match to d3f8fa_
    complexed with glc, ipa, po4

Details for d5h20a_

PDB Entry: 5h20 (more details), 2.5 Å

PDB Description: x-ray structure of padr-like transcription factor from bacteroid fragilis
PDB Compounds: (A:) Putative PadR-family transcriptional regulatory protein

SCOPe Domain Sequences for d5h20a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h20a_ a.4.5.0 (A:) automated matches {Bacteroides fragilis [TaxId: 272559]}
dnvksqmrkgmleycimlllhkepayasdiiqklkearlivvegtlyplltrlknddlls
yewvestqgpprkyykltgkgesflgeleaswkelnetvnhia

SCOPe Domain Coordinates for d5h20a_:

Click to download the PDB-style file with coordinates for d5h20a_.
(The format of our PDB-style files is described here.)

Timeline for d5h20a_: