Lineage for d5iolj1 (5iol J:2-149)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2557935Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2557936Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 2558192Protein automated matches [190032] (18 species)
    not a true protein
  7. 2558299Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [330659] (3 PDB entries)
  8. 2558309Domain d5iolj1: 5iol J:2-149 [330753]
    Other proteins in same PDB: d5iola2, d5iolb2, d5iolc2, d5iold2, d5iole2, d5iolf2, d5iolg2, d5iolh2, d5ioli2, d5iolj2, d5iolk2, d5ioll2
    automated match to d5bxib_

Details for d5iolj1

PDB Entry: 5iol (more details), 1.74 Å

PDB Description: crystal structure of nucleoside diphosphate kinase from schistosoma mansoni
PDB Compounds: (J:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d5iolj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5iolj1 d.58.6.1 (J:2-149) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
ertfimvkpdgvqrglvgeviqrferrgyklvaikmmhaseqllqthyealkslsffpkl
vaymssgpvvpmvfegrkvvengrtmlgatkpeascpgsirgdycqdvgrnvvhgsdste
sanreinlwfspqelcqykqavdpwihe

SCOPe Domain Coordinates for d5iolj1:

Click to download the PDB-style file with coordinates for d5iolj1.
(The format of our PDB-style files is described here.)

Timeline for d5iolj1: