Lineage for d5i96b_ (5i96 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905791Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2905792Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2905793Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
    the active site is between the two identical subunits
  6. 2905990Protein automated matches [190072] (22 species)
    not a true protein
  7. 2906062Species Human (Homo sapiens) [TaxId:9606] [189131] (10 PDB entries)
  8. 2906065Domain d5i96b_: 5i96 B: [330742]
    Other proteins in same PDB: d5i96a2
    automated match to d1lwda_
    complexed with 69q, act, ca, gol, na, ndp; mutant

Details for d5i96b_

PDB Entry: 5i96 (more details), 1.55 Å

PDB Description: crystal structure of human mitochondrial isocitrate dehydrogenase (idh2) r140q mutant homodimer in complex with ag-221 (enasidenib) inhibitor.
PDB Compounds: (B:) Isocitrate dehydrogenase [NADP], mitochondrial

SCOPe Domain Sequences for d5i96b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i96b_ c.77.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rikvakpvvemdgdemtriiwqfikeklilphvdiqlkyfdlglpnrdqtddqvtidsal
atqkysvavkcatitpdearveefklkkmwkspngtiqnilggtvfrepiickniprlvp
gwtkpitigrhahgdqykatdfvadragtfkmvftpkdgsgvkewevynfpaggvgmgmy
ntdesisgfahscfqyaiqkkwplymstkntilkaydgrfkdifqeifdkhyktdfdknk
iwyehrliddmvaqvlkssggfvwacknydgdvqsdilaqgfgslglmtsvlvcpdgkti
eaeaahgtvtrhyrehqkgrptstnpiasifawtrglehrgkldgnqdlirfaqmlekvc
vetvesgamtkdlagcihglsnvklnehflnttdfldtiksnldral

SCOPe Domain Coordinates for d5i96b_:

Click to download the PDB-style file with coordinates for d5i96b_.
(The format of our PDB-style files is described here.)

Timeline for d5i96b_: