Lineage for d1qmvi_ (1qmv I:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2877441Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2877753Protein Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) [52906] (3 species)
  7. 2877754Species Human (Homo sapiens) [TaxId:9606] [52908] (5 PDB entries)
  8. 2877773Domain d1qmvi_: 1qmv I: [33074]

Details for d1qmvi_

PDB Entry: 1qmv (more details), 1.7 Å

PDB Description: thioredoxin peroxidase b from red blood cells
PDB Compounds: (I:) peroxiredoxin-2

SCOPe Domain Sequences for d1qmvi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qmvi_ c.47.1.10 (I:) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Human (Homo sapiens) [TaxId: 9606]}
asgnarigkpapdfkatavvdgafkevklsdykgkyvvlffypldftfvcpteiiafsnr
aedfrklgcevlgvsvdsqfthlawintprkegglgplniplladvtrrlsedygvlktd
egiayrglfiidgkgvlrqitvndlpvgrsvdealrlvqafqytdehgevcpagwkpgsd
tikpnvddskeyfskhn

SCOPe Domain Coordinates for d1qmvi_:

Click to download the PDB-style file with coordinates for d1qmvi_.
(The format of our PDB-style files is described here.)

Timeline for d1qmvi_: