Lineage for d5il8a2 (5il8 A:221-548)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2731436Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2731437Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2731692Family a.128.1.3: Terpenoid cyclase C-terminal domain [48583] (3 proteins)
    automatically mapped to Pfam PF03936
  6. 2731717Protein automated matches [227033] (2 species)
    not a true protein
  7. 2731723Species Tobacco (Nicotiana tabacum) [TaxId:4097] [225866] (23 PDB entries)
  8. 2731741Domain d5il8a2: 5il8 A:221-548 [330735]
    Other proteins in same PDB: d5il8a1
    automated match to d3m00a2
    complexed with 6bx, 6by, ca

Details for d5il8a2

PDB Entry: 5il8 (more details), 2.3 Å

PDB Description: tobacco 5-epi-aristolochene synthase with mopso buffer molecule and ca2+ ions
PDB Compounds: (A:) 5-epi-aristolochene synthase

SCOPe Domain Sequences for d5il8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5il8a2 a.128.1.3 (A:221-548) automated matches {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
knnvllrfakldfnllqmlhkqelaqvsrwwkdldfvttlpyardrvvecyfwalgvyfe
pqysqarvmlvktismisivddtfdaygtvkeleaytdaiqrwdineidrlpdymkisyk
aildlykdyekelssagrshivchaiermkevvrnynvestwfiegytppvseylsnala
tttyyylattsylgmksateqdfewlsknpkileasviicrviddtatyeveksrgqiat
gieccmrdygistkeamakfqnmaetawkdinegllrptpvstefltpilnlarivevty
ihnldgythpekvlkphiinllvdsiki

SCOPe Domain Coordinates for d5il8a2:

Click to download the PDB-style file with coordinates for d5il8a2.
(The format of our PDB-style files is described here.)

Timeline for d5il8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5il8a1