SCOPe 2.08: Domain d5j5ha1: 5j5h A:1-205

Lineage for d5j5ha1 (5j5h A:1-205)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins)
   automatically mapped to Pfam PF02931

6. Protein automated matches [190922] (2 species)
   not a true protein

7. Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (38 PDB entries)

8. Domain d5j5ha1: 5j5h A:1-205 [330732]
   Other proteins in same PDB: d5j5ha2, d5j5hb2, d5j5hc2, d5j5hd2, d5j5he2, d5j5hf2, d5j5hg2, d5j5hh2, d5j5hi2, d5j5hj2
   automated match to d3u8kd_
   complexed with 6gk, nag, po4

Details for d5j5ha1

PDB Entry: 5j5h, 2.7 Å

PDB Description: x-ray structure of acetylcholine binding protein (achbp) in complex with 6-(2-methoxyphenyl)-n4,n4-bis[(pyridin-2-yl)methyl]pyrimidine-2, 4-diamine

PDB Compounds: (A:) acetylcholine-binding protein

SCOPe Domain Sequences for d5j5ha1:

Sequence, based on SEQRES records:

>d5j5ha1 b.96.1.1 (A:1-205) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
nsvtysccpeayedvevslnfrkkg

Sequence, based on observed residues (ATOM records):

>d5j5ha1 b.96.1.1 (A:1-205) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdptdseyfsqysrfeildvtqkknsvty
sccpeayedvevslnfrkkg

Timeline for d5j5ha1:

• d5j5ha1 first appeared in SCOPe 2.06
  
• d5j5ha1 appears in SCOPe 2.07