| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.3: Cytochromes [47175] (3 families) ![]() Heme-containing proteins |
| Family a.24.3.2: Cytochrome c'-like [47179] (3 proteins) automatically mapped to Pfam PF01322 |
| Protein automated matches [190363] (5 species) not a true protein |
| Species Alcaligenes xylosoxydans [TaxId:85698] [330675] (8 PDB entries) |
| Domain d5jraa1: 5jra A:2-126 [330724] Other proteins in same PDB: d5jraa2 automated match to d4cdaa_ complexed with asc, hec, no, so4; mutant |
PDB Entry: 5jra (more details), 1.38 Å
SCOPe Domain Sequences for d5jraa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jraa1 a.24.3.2 (A:2-126) automated matches {Alcaligenes xylosoxydans [TaxId: 85698]}
fakpedavkyrqsavtlmashfgrmtpvvkgqapydaaqikanvevlktlsalpwaafgp
gteggdarpeiwsdaasfkqkqqafqdnivklsaaadagdldklraafgdvgasckachd
ayrkk
Timeline for d5jraa1: