SCOPe 2.08: Domain d5jsla_: 5jsl A:

Lineage for d5jsla_ (5jsl A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.3: Cytochromes [47175] (3 families)
   Heme-containing proteins

5. Family a.24.3.2: Cytochrome c'-like [47179] (3 proteins)
   automatically mapped to Pfam PF01322

6. Protein automated matches [190363] (5 species)
   not a true protein

7. Species Alcaligenes xylosoxydans [TaxId:85698] [330675] (8 PDB entries)

8. Domain d5jsla_: 5jsl A: [330699]
   automated match to d4cdaa_
   complexed with asc, hec, so4; mutant

Details for d5jsla_

PDB Entry: 5jsl, 1.25 Å

PDB Description: the l16f mutant of cytochrome c prime from alcaligenes xylosoxidans: ferrous form

PDB Compounds: (A:) cytochrome c'

SCOPe Domain Sequences for d5jsla_:

Sequence; same for both SEQRES and ATOM records:

>d5jsla_ a.24.3.2 (A:) automated matches {Alcaligenes xylosoxydans [TaxId: 85698]}
efakpedavkyrqsaftlmashfgrmtpvvkgqapydaaqikanvevlktlsalpwaafg
pgteggdarpeiwsdaasfkqkqqafqdnivklsaaadagdldklraafgdvgasckach
dayrkk

Timeline for d5jsla_:

• d5jsla_ first appeared in SCOPe 2.06
  
• d5jsla_ appears in SCOPe 2.07