![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
![]() | Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
![]() | Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
![]() | Protein Histone H4 [47125] (7 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [192456] (36 PDB entries) |
![]() | Domain d5jrgf_: 5jrg F: [330681] Other proteins in same PDB: d5jrga_, d5jrgc_, d5jrgd_, d5jrge_, d5jrgg_, d5jrgh_ automated match to d1kx3f_ protein/DNA complex; complexed with cl, mn |
PDB Entry: 5jrg (more details), 2.5 Å
SCOPe Domain Sequences for d5jrgf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jrgf_ a.22.1.1 (F:) Histone H4 {Human (Homo sapiens) [TaxId: 9606]} rhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtyteha krktvtamdvvyalkrqgrtlygfgg
Timeline for d5jrgf_: