| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) ![]() |
| Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins) |
| Protein automated matches [190032] (18 species) not a true protein |
| Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [330659] (3 PDB entries) |
| Domain d5iolh1: 5iol H:2-149 [330660] Other proteins in same PDB: d5iola2, d5iolb2, d5iolc2, d5iold2, d5iole2, d5iolf2, d5iolg2, d5iolh2, d5ioli2, d5iolj2, d5iolk2, d5ioll2 automated match to d5bxib_ |
PDB Entry: 5iol (more details), 1.74 Å
SCOPe Domain Sequences for d5iolh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5iolh1 d.58.6.1 (H:2-149) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
ertfimvkpdgvqrglvgeviqrferrgyklvaikmmhaseqllqthyealkslsffpkl
vaymssgpvvpmvfegrkvvengrtmlgatkpeascpgsirgdycqdvgrnvvhgsdste
sanreinlwfspqelcqykqavdpwihe
Timeline for d5iolh1: