Lineage for d5iolh1 (5iol H:2-149)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951070Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2951071Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 2951327Protein automated matches [190032] (18 species)
    not a true protein
  7. 2951434Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [330659] (3 PDB entries)
  8. 2951442Domain d5iolh1: 5iol H:2-149 [330660]
    Other proteins in same PDB: d5iola2, d5iolb2, d5iolc2, d5iold2, d5iole2, d5iolf2, d5iolg2, d5iolh2, d5ioli2, d5iolj2, d5iolk2, d5ioll2
    automated match to d5bxib_

Details for d5iolh1

PDB Entry: 5iol (more details), 1.74 Å

PDB Description: crystal structure of nucleoside diphosphate kinase from schistosoma mansoni
PDB Compounds: (H:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d5iolh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5iolh1 d.58.6.1 (H:2-149) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
ertfimvkpdgvqrglvgeviqrferrgyklvaikmmhaseqllqthyealkslsffpkl
vaymssgpvvpmvfegrkvvengrtmlgatkpeascpgsirgdycqdvgrnvvhgsdste
sanreinlwfspqelcqykqavdpwihe

SCOPe Domain Coordinates for d5iolh1:

Click to download the PDB-style file with coordinates for d5iolh1.
(The format of our PDB-style files is described here.)

Timeline for d5iolh1: