Lineage for d5dk1a1 (5dk1 A:1-227)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2798202Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2798203Protein automated matches [190438] (36 species)
    not a true protein
  7. 2798519Species Saccharopolyspora erythraea [TaxId:1836] [237652] (5 PDB entries)
  8. 2798524Domain d5dk1a1: 5dk1 A:1-227 [330636]
    Other proteins in same PDB: d5dk1a2
    automated match to d1kigh_

Details for d5dk1a1

PDB Entry: 5dk1 (more details), 0.94 Å

PDB Description: s. erythraea trypsin mixed catalytic intermediate
PDB Compounds: (A:) Trypsin

SCOPe Domain Sequences for d5dk1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dk1a1 b.47.1.0 (A:1-227) automated matches {Saccharopolyspora erythraea [TaxId: 1836]}
ivggedanvqdhpftvalvtpdgqqfcggtlaapnkvvtaahctvgsqpadinvvsgrtv
mssnegtvskvtnvwvhpeyqdaakgfdvsvltleapvkeapielakaddagyapdtaat
ilgwgntseggqqadhlqkatvpvnsddtckqaygeytpnamvcagvpeggvdtcqgdsg
gpmvvnnkligvtswgegcarpgkpgvyarvgayydvlmeqinagav

SCOPe Domain Coordinates for d5dk1a1:

Click to download the PDB-style file with coordinates for d5dk1a1.
(The format of our PDB-style files is described here.)

Timeline for d5dk1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5dk1a2